SKU: IGF-1 LR3 1mg
IGF-1 LR3 1mg
IGF-1 LR3 1mg is a highly specialised synthetic analogue of insulin-like growth factor-1, engineered for extended half-life and potency in cellular research. With an 83-amino-acid structure including arginine substitution at position 3 and a 13-amino-acid N-terminal extension, IGF-1 LR3 supports investigations into muscle hypertrophy, tissue regeneration, and metabolic regulation via IGF-1 receptor activation.
IGF-1 LR3 1mg is frequently examined in models of muscle growth, injury recovery, and anabolic signalling. Its reduced binding to IGFBPs enables prolonged activity, making it suitable for studies on protein synthesis, myoblast proliferation, fat metabolism, and PI3K/Akt pathway modulation under anabolic or repair conditions. Due to its enhanced bioavailability, IGF-1 LR3 is often selected for research into hyperplasia, glucose uptake, and tissue repair mechanisms in preclinical settings.
Key Features
-
Anabolic Potency – Promotes cell proliferation and protein synthesis to support muscle growth studies
-
Tissue Repair Focus – Used to examine recovery pathways, collagen production, and hyperplasia mechanisms
-
Metabolic Regulation – Enables research into insulin sensitivity, fat oxidation, and bioenergetic shifts
-
Research Only – Intended for qualified professionals conducting advanced scientific investigation
SLU-PP-322 5mg
| CAS Number |
946870-92-4 |
| Molar Mass | 9117.6 g/mol |
| Molecular Formula | C<sub>400</sub>H<sub>625</sub>N<sub>111</sub>O<sub>115</sub>S<sub>9</sub> |
| Chemical Name |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLR RLEMYCAPLKPAKSA (with R3 modification) |
⚠️ Research Use Only Disclaimer
All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.
By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.
By completing your order, you confirm that:
-
You are over 18
-
You understand and accept our [Terms & Conditions]
-
You agree to handle all products in compliance with all applicable laws and safety standards.
89.99 €
Out of stock
Product information
Additional Information
Reviews
Product information
Additional Information
| Retartrutide | Full Reusable Pen Kit with 1 Pre Mixed cartridge 10mg, Peptide Reconstitution Pen Kit with 1 Lyophilized cartridge 10mg, Full Disposable Pen Kit with 1 Pre Mixed cartridge 10mg, Full Disposable Pen Kit with 1 Lyophilized Cartridge 10mg, 1 Pre Mixed Cartridge 10mg, 2 Pre Mixed Cartridges 10mg, 3 Pre Mixed Cartridges 10mg, 1 Lyophilized Cartridge 10mg, 2 Lyophilized Cartridges 10mg, 3 Lyophilized Cartridges 10mg |
|---|
