SKU: LL-37 5mg

LL-37 5mg

 

LL-37 5mg is a highly specialised antimicrobial peptide from the cathelicidin family, researched for its broad-spectrum activity against bacteria, viruses, and fungi. By mimicking innate immune responses, LL-37 supports studies on membrane disruption, immune modulation, and wound healing processes. Its amphipathic alpha-helical structure makes it a key compound for investigators exploring host defence mechanisms and anti-infective strategies.

LL-37 5mg is frequently examined in models of microbial infection, inflammation, or tissue repair. Its 37-amino-acid sequence enables rapid interaction with lipid membranes, making it suitable for research into antimicrobial resistance, angiogenesis promotion, and chemokine induction under stress conditions. Due to its multifunctional properties, LL-37 is often selected for studies on epithelial barrier function, endotoxin neutralisation, and immune cell recruitment in various disease contexts.

Key Features

  • Antimicrobial Action – Targets microbial membranes to support studies on bacterial killing and biofilm disruption

  • Immune Modulation – Used to examine chemokine release, angiogenesis, and wound repair mechanisms

  • Multifunctional Peptide – Enables research into inflammation control, viral inhibition, and cellular signalling

  • Research Only – Intended for qualified professionals conducting advanced scientific investigation

 


LL-37 5mg
CAS Number 154947-66-7
Molar Mass 4493 g/mol
Molecular Formula C<sub>205</sub>H<sub>340</sub>N<sub>60</sub>O<sub>53</sub>
Sequence [LL-37, 37 aa]

⚠️ Research Use Only Disclaimer

All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.

By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.

By completing your order, you confirm that:

  • You are over 18

  • You understand and accept our [Terms & Conditions]

  • You agree to handle all products in compliance with all applicable laws and safety standards.

 

39.99 

Available on back-order